LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4URCPOmdsM1PvTuW3S7GNNmfXMHW8Ok8ljKyLBgunOw. { "context" : "", "truncateBodyRetainsHtml" : "false", ] $('#node-menu li.active').children('ul').show(); { { .attr('aria-hidden','false') nicht über diese Ports nutzbar sind. }, "context" : "", // --> ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6f0c7da46766b0","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6f0c7da46766b0_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GxyFMX-K3ON81UlWi1M7oTEJgQwCZ5UyufB13sDaVf8. .attr('aria-selected','true'); LITHIUM.Loader.runJsAttached(); } }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "pulsate" } createStorage("false"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ Man bekommt hier also eine wirklich komplett kostenlose Simkart… nutzen, Mehr ;(function($) { "actions" : [ { { "context" : "", { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", window.location.replace('/t5/user/userloginpage'); ] "action" : "rerender" "actions" : [ var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "parameters" : { }, "action" : "rerender" { "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], if (element.hasClass('active')) { "event" : "ProductMessageEdit", "event" : "removeThreadUserEmailSubscription", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useSubjectIcons" : "true", "actions" : [ "context" : "", "action" : "rerender" { Vodafone überweisung verwendungszweck Recharge Vodafone Meilleures offres sur les forfaits d'appels et de données de 600 opérateurs Über 80% neue Produkte zum Festpreis; Das ist das neue eBay. ], "action" : "rerender" "event" : "ProductAnswer", } } ] { "kudosable" : "true", "kudosable" : "true", Dein eingesetztes Gerät muss außerdem die technischen Voraussetzungen haben, diese Bandbreiten zu unterstützen. }, element.removeClass('active'); var handleOpen = function(event) { { { }); }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_6f0c7da46766b0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } else { var do_scroll = sessionStorage.is_scroll; { Mehr Infos. }, ctaHTML += "Lösung noch nicht gefunden? }, "event" : "removeMessageUserEmailSubscription", } if ( !watching ) { "context" : "", $('#custom-overall-notif-count').html(notifCount); "actions" : [ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "context" : "", CookieManager = { ] LITHIUM.AjaxSupport.ComponentEvents.set({ Deshalb ist sie in meinem Smartphone als DUAL Sim Karte gelandet. { { Downloads und das Laden von Internet-Seiten sind deutlich verlangsamt oder nicht möglich. { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); { $(document).keydown(function(e) { Sicherlich kannst Du bei Deiner Bank einen Dauerauftrag hintelegen. "event" : "MessagesWidgetMessageEdit", }, }, return; } Angaben zu den dauerhaft gesperrten Ports und zu den Auswirkungen auf die Anwendungs- bzw. }, }, an diese Rufnummer. }, { } } }); "event" : "editProductMessage", { .attr('aria-hidden','false') { "actions" : [ "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] Kann mir dafür jemand die Daten geben, die ich dafür brauche ? "event" : "deleteMessage", Die Bankverbindung lautet: Vodafone D2 GmbH Kto.-Nr. ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0c7da623cd06', 'disableAutoComplete', '#ajaxfeedback_6f0c7da46766b0_0', 'LITHIUM:ajaxError', {}, '0ZH82fTG_eWlCzg8OJPpwFD5EV9kgX1Ku5pTQptxpPE. "event" : "addThreadUserEmailSubscription", "selector" : "#messageview_0", } { ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hnH4axFSVjXdOB9vrqh2ASzho4HkuiSQOyARU2IQrRo. Deine individuelle Bandbreite hängt unter anderem von Deinem Standort und der Anzahl gleichzeitiger Nutzer in Deiner Funkzelle ab. "action" : "rerender" var count = 0; //$('#community-menu-toggle').removeClass('active') Audio- und Video-Streaming-Dienste sind nicht oder nur mit erheblichen Einschränkungen nutzbar. .attr('aria-selected','false'); So kannst Du zahlen: { "event" : "addMessageUserEmailSubscription", }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "removeMessageUserEmailSubscription", { "event" : "ProductAnswerComment", }); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "lia-deleted-state", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.Dialog({ Finde Vodafone… "componentId" : "kudos.widget.button", ] LITHIUM.Dialog.options['-1390132047'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } ] Es gibt bei CALLYA die Möglichkeit für einen Guthabentransfer. "event" : "approveMessage", }, "event" : "MessagesWidgetEditAction", }, Hilfe zu Kennwörter & Zugangsdaten, Zugangsdaten vergessen }, ] "actions" : [ { LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "linkDisabled" : "false" { "defaultAriaLabel" : "", "event" : "MessagesWidgetCommentForm", "action" : "rerender" watching = false; var ctaHTML = ''; 1. }, $(this).addClass('active') $('#community-menu-toggle').click(function() { { "action" : "rerender" }, $('#community-menu-toggle').click(function() { "truncateBodyRetainsHtml" : "false", Juli 2020 bis zum 31. count = 0; "context" : "", "context" : "envParam:selectedMessage", { { "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '8CvH-3bQR92Ele7P_1VxPKxCzn29I_CjBNad1qYztb8. element.find('li').removeClass('active'); "event" : "RevokeSolutionAction", ] für Katastrophenfälle. "event" : "approveMessage", { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } Der entsprechende Betrag kann erst nach dem Zahlungseingang bei Vodafone Deinem CallYa-Konto gutgeschrieben werden. Um Engpässe zu vermeiden, behält Vodafone sich vor, Verkehrsmanagement-Maßnahmen einzuführen, um den Verkehrsfluss zu optimieren. "context" : "", { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); //$('#community-menu-toggle').removeClass('active') "context" : "envParam:entity", $(document).ready(function(){ Die Bankverbindungen von Vodafone findest Du hier: http://www.vodafone.de/infofaxe/175.pdf Betreff Deine CallYa-Rufnummer und fertig. { }, Direkt Vodafone Aufladecode erhalten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); if ( watching ) { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-816415 .lia-rating-control-passive', '#form_0'); Wenn Sie das vereinbarte Datenvolumen erreicht haben, surfen Sie mit geringerer Geschwindigkeit weiter. Drück danach auf "senden". ] "useTruncatedSubject" : "true", // console.log(key); Beispiel: Bei einer Aufladung von 15 Euro schreiben wir dem Kundenkonto 15,38 Euro gut. }, Bist du sicher, dass du fortfahren möchtest? "componentId" : "forums.widget.message-view", }(LITHIUM.jQuery)); "action" : "rerender" return; "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", } "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '8CvH-3bQR92Ele7P_1VxPKxCzn29I_CjBNad1qYztb8. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", Vodafone CallYa bietet vier verschiedene Prepaid-Tarife: CallYa Talk & SMS (Stand-By Erreichbarkeit), CallYa Flex (Wenigtelefonierer Tarif), CallYa Smartphone Special (Smartphone Tarif), CallYa Smartphone Allnet Flat (Vieltelefonierer Tarif). ] Oder wenn es nicht mehr für den Basispreis Deines Tarifs oder Deiner Tarifoptionen ausreicht. LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ;(function($) { "actions" : [ "action" : "rerender" ;(function($) { Es können darüber hinaus kurzfristige Sperrungen eingerichtet sein. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } { } logmein: [76, 79, 71, 77, 69, 73, 78], //} else { $(document).ready(function(){ { "action" : "pulsate" ] { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); watching = true; } // enable redirect to login page when "logmein" is typed into the void =) Instant Messaging Dienste, E-Mails oder vergleichbare Dienste können Sie weiterhin nutzen. Für Bestellungen, die bis zum 31.12.2020 ausgeliefert werden, gilt aber noch die MwSt. CookieManager = { { "message" : "816415", "showCountOnly" : "false", } else { }, $(document).ready(function() { "actions" : [ LITHIUM.CustomEvent('.lia-custom-event', 'click'); LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_6f0c7da46766b0","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); ] "event" : "addThreadUserEmailSubscription", }; "eventActions" : [ window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Dauerauftrag-f%C3%BCr-Callya-Aufladung/td-p/816413" + "/page/" + 1; lithadmin: [] window.scrollTo(0,position_x.top - 150); "actions" : [ })(LITHIUM.jQuery); {